DPCstruct | MC55023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 201 ± 27 aa |
| Standard deviation of domain lengths | 26.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A421FRB7 | 2-196 | PVMLMTIFGVTGYLSDGTFLIEYKDSYFAYSQMDLVMSGGCTPCHVICKRVLHQMATFNHEALMSKPTFEDLYTATSWDYSILSAEA… |
| A0A6A4CHD0 | 33-210 | AFTEQDMTMSGGCSGCIGPCKITLLKYTLFNGSAFVSSPVFNAFVALGPVESLYDFTSLSPEALALGESLDRNGAVCQSGINEWGAT… |
| A0A6A3KBU9 | 118-311 | None |
| W2XZ52 | 15-184 | None |
| A0A6A3V6Z8 | 43-238 | None |
| G4ZUX9 | 1-239 | None |
| A0A6A4EWZ0 | 1-163 | None |
| H3GIG6 | 13-208 | None |
| H3GIA8 | 14-245 | None |
| A0A6A3PU76 | 53-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.