DPCstruct | MC55019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 361 |
|---|---|
| Mean domain length (aa) | 132 ± 25 aa |
| Standard deviation of domain lengths | 24.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 99.34 |
| Assigned Pfam label(s) | CL0123- CL0192- CL0167- PF08430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8ULB4 | 387-517 | EPHKAYGEALEYTGSYSLYDANADPPYSQLIYEALRTAPGKKLPLQGIYGWFEKNTAKGKDGNSKGWQNSIRHNLSMNAGFEAIREE… |
| S4PY66 | 13-113 | EPKPQHSYIGLIAMAILNSPDCKLVLSDIYQHILDNYPYFRSRGPGWRNSIRHNLSLNDCFVKAGRSANGKGHYWAIHPANIEDFRK… |
| A0A654HXK8 | 210-319 | None |
| W5LXW9 | 25-178 | None |
| A0A1V8SWU0 | 123-273 | None |
| A0A1D2NB64 | 488-613 | None |
| A0A7E4W3R1 | 149-274 | None |
| H3AP50 | 30-146 | None |
| R4WDS6 | 10-161 | None |
| A0A1Y1NLT0 | 459-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.