DPCstruct | MC55016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 188 ± 33 aa |
| Standard deviation of domain lengths | 32.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0323- PF00909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9RXJ4 | 13-185 | WGTTNNFLYQCKDKIPEDSDLFDKEHIHLIDAGLEINTPYPLMLPPHRKVDLILSFDFSAGDPFETVKETVKYCKDHQIPFPEIAEE… |
| A0A4W5LCW4 | 5-146 | EKIHLVDAGLKINSPYPTILRTERDVDLIISLDFSAGDPFETVFSAKEYACQQKLPFPPVNESVREENDHPQDCYVFEGRRPEEPTV… |
| A0A146HYG5 | 543-781 | None |
| A0A3S0Z6S3 | 423-601 | None |
| A0A7S2SFB5 | 791-965 | None |
| K7FIK8 | 7-147 | None |
| W5M541 | 15-165 | None |
| A0A2C9JZZ8 | 18-199 | None |
| A0A2D4IWT6 | 49-221 | None |
| A0A2J8IJW7 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.