DPCstruct | MC55012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9RSZ9 | 1-111 | MFQIQLSIQQFYSFRYKGSLMDDGALIQAAAQGALSPEYTKLCAWLVAELKLFCKLEESVEATNSPTEAEGFQLEVSGLLTEMNCPY… |
| A0A6P3F1V3 | 5-113 | LMEPDILESLEDLGYKGPLLEDGALSQVVSAGASSLEFTKLCAWLVSELRVLCKLEENVQATNSPNEAEEFQLEVSGLLGEMNCPYL… |
| A0A6L2Q4L7 | 1-107 | None |
| A0A803XV73 | 11-92 | None |
| A0A5N4A436 | 8-111 | None |
| E9GB19 | 7-133 | None |
| A0A4C1XFP2 | 1-107 | None |
| A0A7R8VSJ7 | 1-107 | None |
| A0A3B4AVK3 | 1-108 | None |
| A0A7R9GBP4 | 243-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.