DPCstruct | MC55007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9RI03 | 1-63 | MEEVGDFEVKAKFMGVQMETYMLHYQDLLQLQYEGVAVMKMFDRAKVNVNLLIFLLNKKFYGK |
| A0A401STY1 | 117-184 | FDICPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDKAKVNVNLLIFLLNKKFYGK |
| A0A834CV59 | 196-264 | None |
| S4RYT1 | 560-627 | None |
| A0A834BBY0 | 201-268 | None |
| A0A1V4JJG4 | 909-976 | None |
| A0A833YI85 | 294-361 | None |
| A0A2H8TFL9 | 144-211 | None |
| A0A484D6Z1 | 345-412 | None |
| A0A672FNX4 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.