DPCstruct | MC55006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | CL0023- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9R9R3 | 1-98 | MIFASWDAEEFGLLGSTEWAEENVKILEKRAVAYINADSSVEGNYTLRVDCTPLLYQLVYGLTKEISSPDEGFEGKSLYESWHLKDN… |
| A0A822IFB7 | 200-332 | KSGKWRPRRTIIFGSWGAEEFGLIGSTEFAEDYYSKLRDRTVAYINVDISVFANATLRVQGTPPAQGVVFAASKQVKTPKNDLTVYD… |
| A0A183W9F4 | 63-170 | None |
| A0A1Y3BVB8 | 59-195 | None |
| A0A091DS73 | 765-886 | None |
| A0A7J8WIG3 | 205-330 | None |
| R7UMH0 | 182-314 | None |
| A0A3B3I691 | 35-153 | None |
| A0A2T7NXR5 | 412-548 | None |
| A0A364MYR1 | 658-756 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.