DPCstruct | MC55004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9R8H8 | 11-103 | DSIKKAQSVIACFPKQWFSNLKGGKTIPQLENLARFLTHLSGIIYRQNVGCSDVEKRNARDQIRQIVKLLAAIRALENAVSVANDYN… |
| G3GT42 | 71-178 | MAFQNSEYGDDSIKKAQNVINCFPKQWFVNLKGERTISQLENFCRYLVHLADTIYRNSIGCSDVEKRNARENIKQIVKLLASVRALD… |
| A0A4W3IA76 | 7-97 | None |
| A0A4Z2AXE9 | 248-345 | None |
| V4AFI7 | 400-488 | None |
| A0A7J8HTD7 | 306-411 | None |
| Q8N2J1 | 163-268 | None |
| A0A498MHT5 | 821-911 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.