DPCstruct | MC5500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 307 |
|---|---|
| Mean domain length (aa) | 166 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W0EPN4 | 1-153 | MPTVYITIPDNPGLTELYNKELYLDAMISIDGNGVVDDLEPTAVSIKGRGNSTWNYAKKPYRLKFDKKIAICGLAKAKSYALIANYI… |
| A0A849M4G6 | 20-183 | NAQNPGGSVFSGNQILDFHFYFNQENFLDSLYQSHENEEYIPANVEIKGVLYDSVGVRFKGFSSFHAYPGHKKSLRIKFNKFKKSHR… |
| A0A2D6PRJ4 | 135-325 | None |
| K8FBI4 | 375-538 | None |
| R6XAL0 | 245-423 | None |
| A0A258E8B5 | 35-192 | None |
| A0A202DG42 | 76-252 | None |
| A0A813B8G7 | 172-340 | None |
| A0A3E1ER26 | 676-820 | None |
| A0A7V8YE12 | 148-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.