DPCstruct | MC550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A140J474 | 98-242 | NELEHTKTSFTTQFNTELENIRKKAEELSRKAEVDPYHYESASKAANRLHQELLIASQLYFYHKTPEAYENFKETCQREIERARPVL… |
| A0A098G661 | 789-929 | VKQEHEQNHQAFAAQLKLLDNKIVELDQRGMEKAHKAALDLYDKLNDAGAIYFSNKPTSQSYEVFKKNCNTSIKEARKELDQHRGWS… |
| A0A0W0YKT8 | 930-1098 | None |
| G9EKE3 | 177-310 | None |
| A0A0A8UWV8 | 145-288 | None |
| A0A378KYK8 | 450-609 | None |
| A0A2Z5V5T2 | 590-733 | None |
| A0A370CHU2 | 1-154 | None |
| A0A0W0VKN1 | 357-507 | None |
| A0A098G521 | 1087-1238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.