DPCstruct | MC54999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JZ32 | 1-96 | MIPNIHDEPIPILPRKHPLKKKKLDLQNAFLRSIAPCHIEYLKNMGVTASFNISLLKENKLWGLIACHHYSPKYVIYEIRKICELLG… |
| T2IIL7 | 37-136 | LRMIPNIHDEPIPILPPKHPLKKKKLDLQNAFLRSIAPCHIEYLKNMGVTASFNISLLKENKLWGLIACHHYSPKYVIYEIRKICEL… |
| A0A5C7VWV9 | 112-195 | None |
| A0A285D350 | 1-92 | None |
| A0A6M8HZA9 | 80-163 | None |
| A0A287SDB2 | 40-146 | None |
| A0A0Q7EJH6 | 188-272 | None |
| A0A811QCH7 | 50-163 | None |
| A0A3M3GQK6 | 1-84 | None |
| A0A840G5C1 | 211-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.