DPCstruct | MC54997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 437 |
|---|---|
| Mean domain length (aa) | 164 ± 38 aa |
| Standard deviation of domain lengths | 37.56 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.87 |
| Pfam Score | 99.53 |
| Assigned Pfam label(s) | CL0039- PF12100- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5ZHP8 | 2-105 | SRQYVTTAIDYPNAAPHMGHVLEKVLADVTARWFRLRGDAVRFQIGTDEHGTKIQRTAESEGVTSKELVDRNVPLFEDLYKRLNISH… |
| T2JVM4 | 6-149 | TKPKKFALTTPLYYVNGVPHIGSAYTTIIADVIARHKRLIGDEVLLITGTDEHGQKIQRTAEEKGLAPQKHCDEIVSSFEELWQKLE… |
| A0A2D6QME9 | 16-193 | None |
| A0A1Y1NK07 | 33-146 | None |
| A0A084RTR0 | 23-146 | None |
| A0A7R9LFB9 | 37-180 | None |
| A0A1B0C1R2 | 1-175 | None |
| A0A1B0C165 | 447-678 | None |
| A0A1Q9C2M9 | 78-230 | None |
| A0A6A6KX30 | 2-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.