DPCstruct | MC54993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 8.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JMJ6 | 1-109 | MDNTQFRGAFSRETNTIYFSEKLVRDTVLQFETVEDINSDNQYIQAFVAVWLEEIGHSVEAQLNEEEIAGDEGRILAAVVIGESYTR… |
| A0A552Q277 | 58-164 | PEIEVVNSSVLGSANGAYGISTNKIYLSESFFASASLDALVAVILEEIGHYVDAQVNRVDTVGDEGELFSHLVRGVNLTEAELTYIQ… |
| A0A0D6AV49 | 57-162 | None |
| A0A6I5PA21 | 95-195 | None |
| A0A846DA14 | 52-160 | None |
| I4G4M8 | 57-167 | None |
| A0A350Y115 | 60-197 | None |
| Q118G9 | 85-210 | None |
| A0A2Z2NRU5 | 125-239 | None |
| I4FVR6 | 57-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.