DPCstruct | MC5499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833EQ61 | 2-142 | TILTRAHEDEDAMRDKLFAIIVNKVDIFRGKGIGHFDEDSIIWQPSPHNTAGEFCVDDFNRVNKEVRNYAKEFHHQIYSQLVGLENS… |
| V8C690 | 234-371 | NTILNRTIEIVRTGSGLTNLSKKIDIPIAIAFTKIDAVDELLDPASCLKNDSAHIRKGAFDKIDFEDANNEMQSLVESWLGMELYQT… |
| A0A7K3ZEN1 | 1-101 | None |
| A7BRK6 | 91-196 | None |
| A0A7V3VBL7 | 108-255 | None |
| A0A7C7R897 | 1129-1243 | None |
| A0A843E1J6 | 2-135 | None |
| A0A0M8YME9 | 103-218 | None |
| A0A451B9F1 | 9-134 | None |
| A0A496V7R7 | 263-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.