DPCstruct | MC54984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.50 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | CL0330- CL0004- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7MPY0 | 1-116 | MFPTASLVFSLLAIVYGQQIGTQVAETHHQLTFQQCTMSGCTTLSMPVVVDSNWCWLHSATGYTNCYTSNTWNVILCPDPVACVQNC… |
| L8WEC0 | 288-415 | LLGSVRAQQAGTATAETHPSLPWQKCTKSGGCVTQSSGKIVLDSNWRWVHTTSGYTNCYTGNTWDSTLCPDPTTCASNCALDGADYS… |
| A0A5C3LPS9 | 5-123 | None |
| A0A1Q9EEX3 | 154-275 | None |
| A0A812MDT4 | 771-915 | None |
| G4ZFM5 | 2-113 | None |
| A0A1B8EUF1 | 1-104 | None |
| A0A146HBA1 | 496-622 | None |
| A0A284R5K0 | 104-246 | None |
| W2PGP2 | 6-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.