DPCstruct | MC54983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 252 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A425XQX2 | 8-244 | TWTSGKADAAIYYTNTNKNAYIWNSRFNKKLHNLKNYPYTTWYISRSFVRKNKVYYSISNGGKVKGVVWHGYVTPAVVKNLNSFNSD… |
| A0A0R1SKM3 | 1-250 | MLLLPSLIIGFILNQSSTTQAATDRSADSYYLNDSDTWTHYFYNKRTVKSHNAYIWNLKHTKRQHNLNNYKSTDWYVYSFYNKKKDG… |
| A0A512PL00 | 9-278 | None |
| A0A512PNH8 | 1-279 | None |
| A0A5R9CU95 | 3-207 | None |
| A0A4R5NRI5 | 134-376 | None |
| A0A0R1QU25 | 39-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.