DPCstruct | MC5498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19848 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2FDU7 | 19-108 | VEEVTALNTLTAAQGLTLTEAQAAELVAARREALVQTGRVEFGSGVTEKLIRAFYTLPYLTKETYAETLQALTELFYQLKNETDDRV… |
| R6AXI0 | 1-117 | MDSNNSKNADAVFSLSLLSGGAAQKNETRLLLKSNEKAQKYGLVLSRKQAAAIIATRNAALQRTGRMEFGAGVLGRIAEAFCDSPWI… |
| A0A2N3FFY0 | 6-102 | None |
| A0A2N0KEW3 | 5-107 | None |
| A0A6N8ID03 | 6-104 | None |
| A0A1G9CEB4 | 1-104 | None |
| A0A1L5F930 | 1-95 | None |
| A0A1I3QY98 | 1-107 | None |
| A0A1V4ISU7 | 5-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.