DPCstruct | MC5497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 119 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5HGB0 | 1-82 | MIWTANKVALTELLYALHTKGAFNNGAAELKEIASYFEEVFSIDLRQYRRTFLEIRERKSDRTKFLNTLAVGLNKRMEETDE |
| A0A1T5GSE0 | 61-174 | NLIPKVTANDLIQVYLEDRLNNIDLGKRSDNSLIWTTSKTALTELIYALYCHRVFNNGNTDIKLIARTFEDAFNIELGDFYHTFMEL… |
| A0A1H4AA30 | 211-320 | None |
| A0A1V5V5S6 | 219-340 | None |
| G5SMZ6 | 93-203 | None |
| A0A5K7SF01 | 4-111 | None |
| A0A4P8LEQ1 | 9-144 | None |
| A0A840CMM2 | 15-117 | None |
| A0A174V6L8 | 1-157 | None |
| A0A1M3L666 | 33-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.