DPCstruct | MC54967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.31 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF01201- PF15251 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0R523 | 8-123 | ELHRKRYGYRLDYHEKKRKKVGRKAKKKKKKKKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEKRNTKQKDEKTPQGAVPAHLLDREG… |
| A0A821TR02 | 2-111 | PQNEHIELHRKRHGRRFDHYEKQKKKEGRLPHILSKKAQTLRGIKAKLYNKRRQNEKIQMKKTIKSHEEKETKQRQEVPEGALPAYL… |
| A0A7R9A293 | 294-427 | None |
| L9KJG9 | 132-252 | None |
| F0XNS9 | 2-135 | None |
| L7J760 | 1-141 | None |
| A0A507F080 | 493-633 | None |
| A0A162PKZ1 | 1-114 | None |
| A0A2K6SHQ6 | 1-139 | None |
| A0A2K6JWN1 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.