DPCstruct | MC54961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 961 |
|---|---|
| Mean domain length (aa) | 217 ± 57 aa |
| Standard deviation of domain lengths | 57.20 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.60 |
| Pfam Score | 91.94 |
| Assigned Pfam label(s) | CL0125- CL0063- CL0099- CL0591- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F8ACZ2 | 130-325 | VDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEIFKKEHPDRFIECYIAEQNMVSIAVGCATRNRT… |
| A0A0Q6SJ02 | 12-254 | DLFSQGLLFGTTHTSLGQEANAVGVVNALDRERDIVWSNHRCHGHFIAYSGEVEGLIAEIMGRVTGVCGGRGGSQHLCFRNFHSNGI… |
| A0A1F5DJ20 | 15-210 | None |
| A0A845WNF4 | 317-509 | None |
| A0A1A9X9E0 | 2-358 | None |
| A0A1V8SPC3 | 278-592 | None |
| A0A061RGW0 | 10-336 | None |
| A0A819RHT0 | 468-678 | None |
| R7KND4 | 4-378 | None |
| A0A655URP9 | 156-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.