DPCstruct | MC54960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 191 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4YS20 | 64-248 | TPDPITNCPQLRDPLASRPPPAVGGCNQRNIVISGGSTTLRPGVYCGGLRITQGANVRLAPGEYVSKDGSLWIDGGASLSGTYVGFY… |
| A0A0Q6SAM5 | 1-159 | MNAADEVTLKPGVYAFRDGAFTLNTSARVTGKDVQFYFEDAQSPLLLNGAAILQVSAPTKGEHAGILMFQGRKAMDGNVQFRINTSA… |
| A0A660UK08 | 121-325 | None |
| A0A2L0NDY0 | 549-746 | None |
| A0A2V8TR65 | 1-182 | None |
| A0A0B8NYT5 | 65-294 | None |
| A0A537WVK9 | 311-497 | None |
| A0A1W9T8M0 | 558-732 | None |
| A0A534W011 | 644-836 | None |
| A0A1U7CJI8 | 661-862 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.