DPCstruct | MC5495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 471 ± 75 aa |
| Standard deviation of domain lengths | 74.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8MCX8 | 2-450 | ITGLGLGASLGSYWTRRYTVRLTTLAWAQGLIGLASLALVPAFGRLPLFIAQLVIRHADSFASVQILEFLLTFGLMLVPTTLLGMTF… |
| A0A6B1QKA7 | 1-417 | MIESTVRLPVSPRTGRFLVLAGVFVCAACGLVYELELVALAAYLIGDSVTQASVVLSVMVFAMGIGSLLAKRLRHHASAWFGLLESV… |
| M1YYV0 | 35-562 | None |
| A0A849GU53 | 4-378 | None |
| A0A2D5ZB78 | 202-668 | None |
| A0A4R3QQV3 | 2-483 | None |
| A0A3C1ENQ8 | 54-584 | None |
| A0A7V2UZZ7 | 1-495 | None |
| A0A2G6KHH4 | 2-487 | None |
| A0A7Y4SKE7 | 6-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.