DPCstruct | MC54948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A858WZE7 | 9-142 | REVIGCYLKELDERLAPATEREVGASFTALLLAFPAQPLSEAAARIRAGAYFEALDGEPAWAIARAGSRWLRGEVEGNLAFAPSPPQ… |
| A0A5B9CX42 | 11-119 | EVQTLQDCNRLQTLLSRQVTVEHIGAAAYLLSGLKIPANTDSDVIALNYSIALADASEHALKRAVKDVIRGEAKGLSKTFMPTGAEL… |
| A0A1P8QX70 | 2-129 | None |
| A0A285TXR2 | 61-169 | None |
| A0A2P7BPT5 | 35-138 | None |
| E6YYZ7 | 342-489 | None |
| A0A512IS74 | 15-159 | None |
| A0A7Z8R830 | 6-161 | None |
| A0A4Q8ZYH2 | 3-149 | None |
| A0A336NDH3 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.