DPCstruct | MC54944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 425 ± 72 aa |
| Standard deviation of domain lengths | 71.70 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9ZJM6 | 32-460 | VNFINFHLALLRPLQERTAGKSYKADESQVLKKKIQELLPDQSKGQQSVIKRRDNLFQNVWKQRKYHYGSLFASIFYVAVTKDKRRE… |
| A0A1B0CZ15 | 2-393 | GISYVCTVKEDAFPLPLAHLNTAFETTPIFRIQKCINMKDLSTKNCCMIFVDVHARVYENWEAYCKENLLPECIIVAPKKGIFMGKI… |
| A0A2H1VTZ8 | 2-488 | None |
| A0A7R9I1P1 | 279-632 | None |
| A0A1S4FEV4 | 2-430 | None |
| A0A834N1B5 | 70-488 | None |
| A0A6L5D446 | 27-450 | None |
| A0A7E5V9M9 | 10-579 | None |
| A0A2J7PQU0 | 11-475 | None |
| Q19107 | 158-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.