DPCstruct | MC54942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 234 ± 39 aa |
| Standard deviation of domain lengths | 38.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 93.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.61 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0004- PF20774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A852TM64 | 1-243 | MPGFTGTTNGEWQSQSFDLSEYKGQNIKLRLRYATDWGTSHIGFFADNLKVVADGATIVEDGAESSTSPFAFNGFTKMDGNKLTDHY… |
| A0A4Y1Z8U0 | 87-357 | TIEQDWDYASVQVNGKSIPGNITTTSDPNQQSPGNGITGDSKGWIDATFDLSAYAGQKIELSLNYWTDVAVALPGFYVDDLKVTADG… |
| C2MG74 | 418-657 | None |
| A0A4U0SV63 | 180-416 | None |
| A0A5C4VFG6 | 414-700 | None |
| A0A7W1GR53 | 2-303 | None |
| A0A7V3PAA4 | 5-254 | None |
| A0A2Z4WEU3 | 346-523 | None |
| A0A4Q1SWP8 | 511-695 | None |
| A0A243AI48 | 229-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.