DPCstruct | MC5494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 80 ± 17 aa |
| Standard deviation of domain lengths | 16.80 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.41 |
| Pfam Score | 88.90 |
| Assigned Pfam label(s) | PF04992- PF04998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821VQS2 | 3-69 | GREGLIDTAVKTAETGYIQRRLVKAMESVMVKYDGTVRNQKEQLIQFTYGEDGLAAENVEFQSIISL |
| A0A842PHN1 | 151-224 | GREALVDTAVRTSQSGYFQRRLVNALQDLEVKNDETVRETRDTIVQFKYGEDSVDPSKGEYGKVVDIDEIIREV |
| A0A4Z2HLZ3 | 576-659 | None |
| P14248 | 980-1102 | None |
| A0A2G3CZT3 | 413-487 | None |
| A0A843G8S9 | 2-66 | None |
| A0A843GI31 | 87-157 | None |
| A0A843E157 | 469-554 | None |
| A0A815HE76 | 13-79 | None |
| A0A445IKC4 | 6-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.