DPCstruct | MC54937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 190 ± 32 aa |
| Standard deviation of domain lengths | 32.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.52 |
| Pfam Score | 62.60 |
| Assigned Pfam label(s) | PF21222- PF20520- CL0721 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5JN20 | 2-163 | GIELTVQYMVSVFSRQSYFNIDPNATQASGNCGSQVSNLLLNFQGGFVNLTFTKDENSYYISEVGAYLTVSNPEKIYQGMKSAVMFE… |
| C0PUW8 | 2-188 | LQMAAQLNFTYEAREGNFTTGLYNIPSNASVEDAECKSQTTQFIHLIWGPETSKQSLIMYFNKSNDTTVLSFMQIHLALLPEDFPDA… |
| A0A6P6CE05 | 113-292 | None |
| A0A3B5PS29 | 48-247 | None |
| F7E397 | 88-277 | None |
| A0A3Q0J901 | 1-164 | None |
| A0A1B0BV32 | 2-144 | None |
| A0A7E4VIK9 | 25-280 | None |
| A0A0C2I9U5 | 12-250 | None |
| A0A0C2IXC7 | 6-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.