DPCstruct | MC54934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 314 ± 92 aa |
| Standard deviation of domain lengths | 91.59 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.22 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF02690- CL0297- CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I2GCV4 | 36-277 | KELAGDRMRTFLARFTSNPFSGILTGTVATTLLDSSSVVIIMVLTMVNASLISSIESFGVIMGANIGTTISSQIIAFNIAEYSPILL… |
| A0A355SI89 | 31-335 | LVFGVIGGSALLMYGVELMGSSFEKAAGGFIKKTLSIFAGNLLSAFFTGIFITALVQSSTAVTVLTVGFVNAGLMNLNQAVGIIYGA… |
| A0A815P6F0 | 78-486 | None |
| A0A842V3N1 | 65-429 | None |
| A0A011N3R5 | 3-246 | None |
| A0A067BVN9 | 31-441 | None |
| Q53W26 | 2-334 | None |
| T0CM74 | 2-211 | None |
| A0A7I8CT77 | 5-308 | None |
| A0A7V5C2S0 | 4-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.