DPCstruct | MC5493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 180 ± 41 aa |
| Standard deviation of domain lengths | 41.20 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF08708- CL0242 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5BJS7 | 4-124 | GSVDQSLFPPCIKEYLVEVRDGVNLPHMARFTLVSFLHKIGMQNPEIMALFKTAPDFNQRITEYQVDHVTGQISGTEYSPPKCEVLR… |
| A0A842PHM6 | 16-196 | SEFVRIIQEAIYERIKKDLPLDVPADICEAISRYTVDIKKELEEKRKKFGDAGFESGSGFLVKDPNCFPPCISYILSNLKEGVNVPH… |
| A0A2H5UWT5 | 252-424 | None |
| A0A0F8RH79 | 208-421 | None |
| A0A2V3I6J4 | 320-530 | None |
| A0A496UHH6 | 96-335 | None |
| A0A7J3TB56 | 6-169 | None |
| A0A7C2WFZ8 | 2-149 | None |
| A0A7C3S8H5 | 65-188 | None |
| A0A7C4DEX6 | 30-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.