DPCstruct | MC54927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0XYI1 | 37-137 | VQVEVRWLQKLAAHAAIKEVPAFAADANGFLDKIVADFSVEDAERIKTIERTTNHDVKAVEYFLKEKVADVAELHAVSEFIHFACTS… |
| A0A7J6QXV7 | 1-95 | MSDRSEFPEVPSLTSEQRAKLSAIASDLTVADGLRVKEIERTTNHDVKAVEYLIKEKLHSTGDPTLAKLTEFTHFACTSEDINNLSY… |
| A0A2J7ZZC1 | 75-170 | None |
| A0A6P5TXS2 | 222-322 | None |
| A0A6D2KCJ5 | 155-250 | None |
| A0A484MLU5 | 153-243 | None |
| A0A377F6G5 | 1-97 | None |
| A0A812P1I4 | 402-506 | None |
| A0A1B0C713 | 359-441 | None |
| A0A6N9BQG2 | 47-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.