DPCstruct | MC5491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A386XRV3 | 6-68 | ETETFLGYCFDAEGRYPSPVSLHGIEQAVGYFKLQMPLHPRVMITDQRDYCVLEAQNGKITFP |
| A0A1V5BB66 | 210-293 | REPKYSGYSFLPDGRYAAGVWLCGEKEVKDYIEMQKDYQHQVMICDRDDFCVLEMVNGEIIHPSPKVLQDFCQGREPGGQNMNL |
| A0A7W2HCU0 | 1-64 | None |
| A0A1C0BQ52 | 2-66 | None |
| I4DCU5 | 222-291 | None |
| A0A1V4FPL2 | 1-69 | None |
| A0A4R1QTC8 | 30-103 | None |
| W4BPM6 | 4-78 | None |
| A0A1H8LBS1 | 3-84 | None |
| A0A6I4VXN7 | 2-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.