DPCstruct | MC54906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2BZ32 | 270-369 | DFYQMHCYAWGTEWSPNAPFAVVAGDYGLNKPNVIGEFASVCAQTGSTLPGLFTYAYENGYSGAWTWHYTATGDCSDSRDAQREALG… |
| A0A7R9MPU1 | 1-98 | DFYQIHSYECGQEHPIKRSAQQYGLDKPLMVGEFSTKRSCVSDSAEVYKHYYFSGYNGCMAWQYNDHQDNDRDTRDVINHGIESIRH… |
| A0A5N5TCM1 | 180-265 | None |
| A0A210PIB1 | 422-516 | None |
| A0A7S4NLK7 | 99-195 | None |
| A0A7S4P9T5 | 218-304 | None |
| E9HZQ6 | 59-163 | None |
| A0A7T9EB28 | 286-390 | None |
| A0A653DUQ9 | 95-195 | None |
| A0A7R9KXE9 | 279-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.