DPCstruct | MC54905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03153 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9MNF1 | 3-95 | YRDRDDDDHEDNDEEVNDDDNDGQGEDEEPLNSEDDVSDEDPTELFETDNVVVCQYDKITRSRNKWKFHLKDGIMNLQGKDYVFQKA… |
| A0A2P6Q9S0 | 12-60 | SMNTQNLVLAQFEKVKRTKSKWKCTLKDGIMHMNNRDILFNKATGDFDF |
| A0A1Y1W381 | 116-200 | None |
| A0A1I7TYQ9 | 161-265 | None |
| A0A438F9M2 | 90-164 | None |
| A0A3P8GSQ7 | 60-158 | None |
| A0A4D9A4H4 | 637-703 | None |
| A0A1E4RZX8 | 2-76 | None |
| A0A0K6GDL4 | 497-576 | None |
| A0A1Y2D870 | 248-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.