DPCstruct | MC54902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 165 ± 18 aa |
| Standard deviation of domain lengths | 18.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419PC95 | 2-132 | ATRLSYPCAAKLEDPGDLPHCFAIYYSKEGVRQYDLRADTEEECHLWVDAINNASFGKMLEQKQEAEQKQLHLLQILETERRAKWHY… |
| T0NMT2 | 1-161 | MGRLGGPSLHLTTCLSPPGFTRTRPQRPLKHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQI… |
| A0A0G2JW65 | 67-245 | None |
| A0A1A6HQY5 | 2-179 | None |
| A0A2I0TXC9 | 221-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.