DPCstruct | MC5490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 101 ± 6 aa |
| Standard deviation of domain lengths | 5.82 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0202- PF02924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081FX72 | 2-91 | LTSIADTGNTGDGTVTALSTSTKLKKGTYEIKIIEPAPDGGLFQLLNTRGKVAGVGTVGQAFEAEGLSFTLQDGTTDFALNDRFTIT… |
| A0LBF3 | 207-311 | ATWGSWTGSTVAGTYDGSGPTIAPTNIIPILDFIGSIEQTWTLTFSDANSFSCVGDTLGSVGSGSISGGDFAPNNPDFSRPYFTLPV… |
| A0A349U0I2 | 8-108 | None |
| A0A530YYJ9 | 137-239 | None |
| A0A1G3AE02 | 21-123 | None |
| A0A0F9EMA1 | 19-110 | None |
| B4D587 | 428-538 | None |
| A0A072TE80 | 40-145 | None |
| A0A1T5BNM9 | 57-152 | None |
| A0A2P8NEV3 | 23-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.