DPCstruct | MC549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 282 ± 32 aa |
| Standard deviation of domain lengths | 31.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6VNK6 | 9-311 | VLKVAEYVYQERLSKPYTEVGPEWEYNHKTPYATRATGTGHNLQRFITIDDQRLHRPIHGLAHTMRTLFYSQLMYEAAKRQPHPHRC… |
| A0A098G396 | 664-965 | DYGAQALIFADNKFLSKKYTEERAGTYFPILYKQNGNTISGLTSHYDCYNGDEAAVYRSNHGLCHTARTQFLVRMVVDFNLKYAAPD… |
| A0A7W1MEJ1 | 1-298 | None |
| A0A1G0HZD8 | 752-1027 | None |
| A0A0W0R2A7 | 7-292 | None |
| A0A2K9JZZ2 | 92-412 | None |
| A0A0Q9Y9U8 | 782-1060 | None |
| A0A7G4RIY8 | 4-277 | None |
| A0A3A5LAZ8 | 110-390 | None |
| A0A2S8C9H8 | 231-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.