DPCstruct | MC54895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 269 ± 72 aa |
| Standard deviation of domain lengths | 72.21 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0123- PF09110- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9XV93 | 396-611 | KIPKVPRNPDIPNPAVAQREEQKKIDGAEPLTPEETEEKEKLLTQGFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVME… |
| A0A7J8ELS9 | 45-300 | VQDFQFFPPRLFELLEKEILYYRKTIGYKVPRNPDIPNQAVAQREEQKKIDEAEPLTPEETEEKEKLLTQGFTNWTKRDFNQFVKAN… |
| A0A0A9XCT6 | 177-500 | None |
| A0A7S2RM12 | 6-252 | None |
| A0A7S3ZYE5 | 183-460 | None |
| A0A7S4NZ52 | 2-171 | None |
| A0A6A4JR15 | 3-154 | None |
| A0A7J6UEU6 | 129-418 | None |
| A0A835RGU4 | 2-344 | None |
| A0A7S1ZY21 | 30-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.