DPCstruct | MC54893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 115 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 69.96 |
| Pfam Score | 51.67 |
| Assigned Pfam label(s) | PF19052- CL0293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8WRK1 | 195-307 | TETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLRGLQIIFPQYLQEKFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPIT… |
| A0A7J7RUF0 | 208-320 | TETRTGPLGCSNYDNLDSVSSVLVQSPENKIQLQGLQALLPDYLQERFVQAALSYIACNSEGEFICKDNDCWCQCGPRFPECNCPSM… |
| A0A3L8SDU8 | 296-430 | None |
| A0A7J8B951 | 5-118 | None |
| A0A4Z2H0D0 | 120-232 | None |
| A0A6I9ND58 | 1-113 | None |
| A0A2P4T8K0 | 51-166 | None |
| A0A662YT49 | 193-305 | None |
| A0A6G0IT74 | 202-305 | None |
| A0A553QIP8 | 142-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.