DPCstruct | MC54892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 509 ± 99 aa |
| Standard deviation of domain lengths | 98.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1Q314 | 27-609 | DLFYKFPLDEYLKSLLILFKSLQPSIDFKKFAENDSYHLNNLGTLNPKIFVYPNFNYLDKLKDIQEINGGLVTEEQISQEQTINDNL… |
| A0A1L0DV18 | 1-379 | MTVGRDDQTFKKLDYAIRYHIFNMGDRNSLLVYSQLLEFAKFQGLKCYTTSCIQFVNSDEPNTIDSVRKQIRLFRYIPWEKSILISA… |
| M9LN20 | 494-938 | None |
| A0A4T0Q679 | 1-361 | None |
| A0A1X0RZ40 | 178-723 | None |
| A0A077WX33 | 109-656 | None |
| A0A4U0XRC7 | 171-660 | None |
| A0A163IXU1 | 172-709 | None |
| A0A0A9XT82 | 78-630 | None |
| A0A0B1P5A1 | 84-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.