DPCstruct | MC54889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Standard deviation of domain lengths | 16.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06803 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H9KWA1 | 6-128 | SPTNNFKEAMTEILMLIPNFMALMYGLIKDSRVPSIEKKILAGTIAYVILPLDLMPDAIPFIGQIDDIFLVAVTLKRILTSVPESIL… |
| A0A7V3P342 | 144-278 | HHRFEQMLRDEVAHYRGRFANQIWLVPDLFRMLTNLLEDGRVDSAARHRIVSALAYFITPFELFPKQLHGPEGYLDQAWLCLQTVKH… |
| A0A419FQF9 | 6-157 | None |
| A0A7V9TV07 | 1-125 | None |
| Q12VT4 | 7-138 | None |
| A0A1X1N567 | 6-109 | None |
| A0A2V7Y1L2 | 30-169 | None |
| A0A6B1E725 | 236-369 | None |
| A0A7C6D7N3 | 36-149 | None |
| A0A7J9THL4 | 16-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.