DPCstruct | MC54886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 156 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0EYM2 | 1-181 | MALFGHRPRTAHPSTGPGRVALLDPRDEGNPKQATFIGLDQAGLSLLIYGPGDIRRCFTALADAAPAFHTTRLASESPYVGCFPGRS… |
| A0A849C3T7 | 3-152 | YDTTLEDPRRTPGDPKQSAYTMLSRARRTHIVYGTASAAECWNAIVEAAPVFADAVAVSRTIGTFANHRHIVWVALEGPHGSAVAIF… |
| A0A1H6IK34 | 158-310 | None |
| A0A839N8P9 | 17-163 | None |
| K0F153 | 5-168 | None |
| A0A6I1GF68 | 8-153 | None |
| A0A1H4J730 | 135-282 | None |
| A0A563DS53 | 160-325 | None |
| A0A0D8I4H5 | 152-301 | None |
| A0A0A1D0M0 | 12-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.