DPCstruct | MC5488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 174 ± 36 aa |
| Standard deviation of domain lengths | 35.91 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 61.61 |
| Assigned Pfam label(s) | CL0040- CL0344- CL0036- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6CH69 | 59-227 | NDYKWQLKNRIFDLDTLLQIIKLEDDEVQAVREVGEQFRWGISPYYLALIDEDNKYDPIKLQAIPTKAELLVGGQADPMGEEYTNPA… |
| A0A2R7Q3S8 | 18-186 | WQQLWRQALRDPQTLLARLDLDAAALGVSEAAIAKFALRVPEGFVARMRRGDAHDPLLRQVLPIDAEMRPAPGFSFDAVGDGAAKKA… |
| A0A3S4JR58 | 25-206 | None |
| A0A0F2QZF7 | 5-160 | None |
| A0A2E6EMI0 | 1-188 | None |
| A0A7Y5JKX0 | 11-233 | None |
| Q3Z9Y0 | 16-182 | None |
| A0A1S3J683 | 1-218 | None |
| H8I4D2 | 116-288 | None |
| A0A6S8UAJ4 | 87-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.