DPCstruct | MC54871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7LTM4 | 70-163 | LAAPEKKELAQRLVASAENSTLDWRSLYGGIEDLGDGQGYTAGTVGFRTGTHDLLTLVERYSEEHPGNGLERYPPALREVDGTDSHE… |
| A0A829RAI5 | 44-163 | TAAKKEIAMELVSSAENSSLKWKKQYAYIEDIKDGRGYTAGIIGFCSGTGDMLQLVESYTKMKPQNVLKKYLPALKKVNGTASHKGL… |
| A0A369QH25 | 1-153 | None |
| A0A2M8BAY2 | 321-459 | None |
| A0A2P6P0D1 | 156-276 | None |
| A0A7R9KT49 | 11-131 | None |
| A0A1W1X910 | 159-290 | None |
| A0A136K2Z1 | 1-146 | None |
| A0A507FIN9 | 87-225 | None |
| A0A162TA77 | 2-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.