DPCstruct | MC54870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 442 ± 45 aa |
| Standard deviation of domain lengths | 45.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CCB6 | 2-384 | LVGLAAVLLSLSSLSDGAWSLAVIPWCAAVMGWVWLRGAGLWRQGRMQRAAHAQASELQTMVLNSKALTSLARKSLRLLQETEVISR… |
| A0A3P8ZE46 | 45-485 | LSDGAWSLAVIPWCAAVMGWVGVRGAGLWRQGRMQRAAHARASELQTAVLNSKALTSLARKSLRLVQETEVISRGFTLVSGVASSFS… |
| A0A395J3G1 | 117-617 | None |
| A0A182W477 | 70-522 | None |
| A0A369GMX6 | 131-612 | None |
| A0A6P5BSK7 | 6-464 | None |
| A0A0N7Z9T9 | 124-576 | None |
| A0A194V002 | 173-613 | None |
| A0A1G4JH54 | 197-688 | None |
| A0A4U0VIW7 | 1-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.