DPCstruct | MC5487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9CCD8 | 35-114 | AVLSLCIIVYHCIKNDCYGNHEKKTEQITVSGTDIEVELAITPEEHMAGLMYRNTLEDNKGMLFVFPDEKRLSFWMKNTY |
| A0A2R7PBZ9 | 1-78 | MSLLRSLLMLPLLALTGCATDAARHWVELDGARYVVELATNDETRARGLMFRDQMAEDHGMLFVHDREEMQAYWMKNT |
| A0A0F8YMZ5 | 7-81 | None |
| A0A258V5P0 | 2-74 | None |
| A0A0G0YQ46 | 15-111 | None |
| A0A1G1YV60 | 1-88 | None |
| A0A846AZ76 | 7-98 | None |
| A0A6I0ETX6 | 13-94 | None |
| A0A843C9A3 | 7-92 | None |
| A0A2M8D823 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.