DPCstruct | MC54862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 217 ± 50 aa |
| Standard deviation of domain lengths | 50.26 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0KAM6 | 35-237 | PDAAELAKLAANATGLTYEAGMAGKFPGGVPGYLVTKVGPFMSAYKQLALKHAEGGSLEAALITCERTQRSFQAWGHPYAFHSRLLA… |
| A0A5B7TJW0 | 51-351 | RIPGEMDFHLIPFGDIGNGDYYCFYKYGASANDYFIGIWLHETRNFVILASTFKSFIYKCLLDDYLSTLIPNDSLSESENAISCEES… |
| A4RYC3 | 22-222 | None |
| A0A7S1VIQ0 | 2-169 | None |
| A0A2E7VPG7 | 157-378 | None |
| A0A7S1P4C3 | 160-409 | None |
| A0A6A0A5T3 | 181-363 | None |
| A0A7S0BCX9 | 3-164 | None |
| R1DXS3 | 472-701 | None |
| A0A0G4G9Y7 | 218-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.