DPCstruct | MC54859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 264 ± 42 aa |
| Standard deviation of domain lengths | 42.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7GAB5 | 205-464 | VQVGNLMDTDSFVCPLTISQIHSSLMQRELGRMQGQFDQVNAIRLELLVYGVRVHDDFRQWTTDPNHVFLANTASKHSPAFPHAYQC… |
| A0A0M0K8Y7 | 15-272 | YTRESGDVYPVDVAAVEQLIEQRVALRLSRDFEGADRLRDRLKEEFGVYVVDPELKWYVGSGARARDRDLYADGERSERRSAQSESA… |
| A0A7S2UK85 | 1-184 | None |
| A0A6T7S4T0 | 1-249 | None |
| A0A0M0JZ43 | 41-360 | None |
| A0A7S3SYE9 | 231-510 | None |
| A0A7S3SP76 | 61-348 | None |
| K0RTG2 | 71-294 | None |
| A0A7S4N1J8 | 2-205 | None |
| A0A7S4RHJ6 | 2-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.