DPCstruct | MC54855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 329 ± 49 aa |
| Standard deviation of domain lengths | 49.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.60 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0220- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0QNV9 | 185-497 | LFAKWQPDNEEILNKCFDFDWDNSKIPQKVKNKEDQELLKQFLREKYKLIKDAYKHFATFNPIQDIWCIQNAPWLEFISQLKIIDQK… |
| A0A0M0K2F6 | 13-318 | GTSEEHDWHALVRVWMTNLAPVRLAYRLYVMLGNIEAAPKDISLTQFRKFVEDCHVLKPVLSSKVDVDLIFTRANRVNVHHGAGEYE… |
| A0A7S1XWX3 | 8-331 | None |
| A0A7S3ZJ00 | 36-273 | None |
| A0A067BDW8 | 224-519 | None |
| A0A067C985 | 3-338 | None |
| A0A0S4JNC7 | 675-996 | None |
| A8JE03 | 448-832 | None |
| A0A7S1MSR4 | 100-386 | None |
| A0A3R6WN73 | 918-1226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.