DPCstruct | MC54853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 413 ± 58 aa |
| Standard deviation of domain lengths | 57.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0K036 | 8-404 | EAYAGTFSFNVKRVCWYLDSQFCAPFHKLKQSLGSPGNARLLIWGLTYGVTAIAILFYFCLVATIVMRTLHCGVCEDADERDAKGAH… |
| A0A0M0JH18 | 105-616 | ARSFDKWAANNRNFKFTDMTKECTIAGLNFGPPTSGRRHTGTACTPANQPSGCVMPHSGCPLAEIWVTSKIGPYSTPASIAAASESS… |
| A0A7R9ULA3 | 101-528 | None |
| A0A7S3RPI2 | 75-473 | None |
| A0A7S0EPG6 | 211-614 | None |
| A0A7S4F5S6 | 123-641 | None |
| A0A7S3AEA7 | 1-427 | None |
| A0A0M0JIQ4 | 175-501 | None |
| A0A0M0JBW9 | 73-495 | None |
| A0A7S3RV88 | 210-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.