DPCstruct | MC54852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 260 ± 59 aa |
| Standard deviation of domain lengths | 58.69 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 90.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0JYK1 | 266-549 | AAAAKPAAAKVNEAFVFIKPHANNKAVQDLVRSKFGEKGIEIATLSKPADLNVPAAKFADFFGEEWTTVLAEDRAFNALDMKEKLGG… |
| A0A7S2TMS2 | 56-213 | NGFYMSMREKYTKPGKSIYFMTVEWPSASLSWEDFRAKVLGGTDPSAAAAGSVRNDIYLNWESLKLPGKPNVGDNGVHASASPFEGM… |
| A0A559UDI3 | 108-417 | None |
| A0A7S1FGY9 | 205-504 | None |
| A0A7S0AYD6 | 8-180 | None |
| K8EKV9 | 4-315 | None |
| A0A1Q9C1N3 | 232-433 | None |
| R1CFE4 | 4-154 | None |
| A0A7I8CQA5 | 7-276 | None |
| A0A7S4ICW1 | 1-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.