DPCstruct | MC54851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 143 ± 29 aa |
| Standard deviation of domain lengths | 29.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 95.26 |
| Assigned Pfam label(s) | PF05209- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7D1F2 | 37-159 | VMTNNAAEKWKHEDEVLPLSRLIRSGQLVESGAHMLIVGEINPGGHVEVVEHAFVMGQVKGTIHAGKNGNMKAVIIGCFQYPAQLRI… |
| A0A7V4KD65 | 2-84 | VILVGNLHAGAEIVAGGSVVIFGRCQGTVRAGINEGRESVIIALSFEAPFVQISDLKGTFTEKFNHPVVLHVKAGRIEVGKYD |
| A0A254UR41 | 222-368 | None |
| K6QCB1 | 660-790 | None |
| C5T5F9 | 34-157 | None |
| K8E9G4 | 26-174 | None |
| A0A1I6DQI7 | 2-126 | None |
| A0A7V9L6K3 | 221-351 | None |
| A0A143X3U0 | 1-184 | None |
| A0A6N8W8D1 | 105-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.